Recombinant Full Length Human Olfactory Receptor 6F1(Or6F1) Protein, His-Tagged
Cat.No. : | RFL29880HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 6F1(OR6F1) Protein (Q8NGZ6) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET LLKKWKGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR6F1 |
Synonyms | OR6F1; Olfactory receptor 6F1; Olfactory receptor OR1-38 |
UniProt ID | Q8NGZ6 |
◆ Recombinant Proteins | ||
NI36-RS11240-0941S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS11240 protein, His-tagged | +Inquiry |
CLVS2-1030H | Recombinant Human CLVS2 Protein (1-327 aa), His-SUMO-tagged | +Inquiry |
ACTA2-11898Z | Recombinant Zebrafish ACTA2 | +Inquiry |
RUVBL2-30950TH | Recombinant Human RUVBL2, His-tagged | +Inquiry |
PNO1-3529C | Recombinant Chicken PNO1 | +Inquiry |
◆ Native Proteins | ||
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRFAP1L1-4208HCL | Recombinant Human MRFAP1L1 293 Cell Lysate | +Inquiry |
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
HJURP-5509HCL | Recombinant Human HJURP 293 Cell Lysate | +Inquiry |
UQCRFS1-725HCL | Recombinant Human UQCRFS1 lysate | +Inquiry |
FAM110B-6454HCL | Recombinant Human FAM110B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR6F1 Products
Required fields are marked with *
My Review for All OR6F1 Products
Required fields are marked with *
0
Inquiry Basket