Recombinant Full Length Human Olfactory Receptor 56A1(Or56A1) Protein, His-Tagged
Cat.No. : | RFL12596HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 56A1(OR56A1) Protein (Q8NGH5) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEA SLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESC TFMVMAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENV IENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGA AVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYG VRTKEIKQGIQKLLQRGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR56A1 |
Synonyms | OR56A1; Olfactory receptor 56A1; Olfactory receptor OR11-75 |
UniProt ID | Q8NGH5 |
◆ Recombinant Proteins | ||
TCF4-742HFL | Recombinant Full Length Human TCF4 Protein, C-Flag-tagged | +Inquiry |
IFITM5-726H | Recombinant Human IFITM5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCT5-1234R | Recombinant Rat CCT5 Protein | +Inquiry |
HSPA14-2943R | Recombinant Rat HSPA14 Protein | +Inquiry |
SCAMP5A-11593Z | Recombinant Zebrafish SCAMP5A | +Inquiry |
◆ Native Proteins | ||
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
PLG-252H | Active Native Human Plasminogen | +Inquiry |
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX54-460HCL | Recombinant Human DDX54 cell lysate | +Inquiry |
PRPF4B-2824HCL | Recombinant Human PRPF4B 293 Cell Lysate | +Inquiry |
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
TACR1-1283HCL | Recombinant Human TACR1 293 Cell Lysate | +Inquiry |
TNFRSF12A-1560HCL | Recombinant Human TNFRSF12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR56A1 Products
Required fields are marked with *
My Review for All OR56A1 Products
Required fields are marked with *
0
Inquiry Basket