Recombinant Full Length Human Olfactory Receptor 52W1(Or52W1) Protein, His-Tagged
Cat.No. : | RFL33674HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 52W1(OR52W1) Protein (Q6IF63) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MAETLQLNSTFLHPNFFILTGFPGLGSAQTWLTLVFGPIYLLALLGNGALPAVVWIDSTL HQPMFLLLAILAATDLGLATSIAPGLLAVLWLGPRSVPYAVCLVQMFFVHALTAMESGVL LAMACDRAAAIGRPLHYPVLVTKACVGYAALALALKAVAIVVPFPLLVAKFEHFQAKTIG HTYCAHMAVVELVVGNTQATNLYGLALSLAISGMDILGITGSYGLIAHAVLQLPTREAHA KAFGTCSSHICVILAFYIPGLFSYLTHRFGHHTVPKPVHILLSNIYLLLPPALNPLIYGA RTKQIRDRLLETFTFRKSPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR52W1 |
Synonyms | OR52W1; OR52W1P; Olfactory receptor 52W1; Olfactory receptor OR11-71 |
UniProt ID | Q6IF63 |
◆ Recombinant Proteins | ||
DRD2-11H | Recombinant Human DRD2 | +Inquiry |
S100g-250R | Recombinant Rat S100g, His-tagged | +Inquiry |
CD164-3044H | Recombinant Human CD164 Protein, MYC/DDK-tagged | +Inquiry |
Ppp1r1b-2634R | Recombinant Rat Ppp1r1b, Phosphorylated | +Inquiry |
IL4-177C | Active Recombinant Canine IL4 Protein | +Inquiry |
◆ Native Proteins | ||
ApoB-3556H | Native Human ApoB | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PF4V1-3282HCL | Recombinant Human PF4V1 293 Cell Lysate | +Inquiry |
UBE2J1-572HCL | Recombinant Human UBE2J1 293 Cell Lysate | +Inquiry |
WDR55-340HCL | Recombinant Human WDR55 293 Cell Lysate | +Inquiry |
SS18L2-1467HCL | Recombinant Human SS18L2 293 Cell Lysate | +Inquiry |
NARG2-1166HCL | Recombinant Human NARG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR52W1 Products
Required fields are marked with *
My Review for All OR52W1 Products
Required fields are marked with *
0
Inquiry Basket