Recombinant Full Length Human Olfactory Receptor 52H1(Or52H1) Protein, His-Tagged
Cat.No. : | RFL14323HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 52H1(OR52H1) Protein (Q8NGJ2) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MPSASAMIIFNLSSYNPGPFILVGIPGLEQFHVWIGIPFCIIYIVAVVGNCILLYLIVVE HSLHEPMFFFLSMLAMTDLILSTAGVPKALSIFWLGAREITFPGCLTQMFFLHYNFVLDS AILMAMAFDHYVAICSPLRYTTILTPKTIIKSAMGISFRSFCIILPDVFLLTCLPFCRTR IIPHTYCEHIGVAQLACADISINFWYGFCVPIMTVISDVILIAVSYAHILCAVFGLPSQD ACQKALGTCGSHVCVILMFYTPAFFSILAHRFGHNVSRTFHIMFANLYIVIPPALNPMVY GVKTKQIRDKVILLFSKGTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR52H1 |
Synonyms | OR52H1; Olfactory receptor 52H1; Olfactory receptor OR11-45 |
UniProt ID | Q8NGJ2 |
◆ Recombinant Proteins | ||
CRADD-1015R | Recombinant Rhesus monkey CRADD Protein, His-tagged | +Inquiry |
CPNE5-2477H | Recombinant Human CPNE5 protein, His-tagged | +Inquiry |
SAP049A-018-2312S | Recombinant Staphylococcus aureus (strain: NE 3868) SAP049A_018 protein, His-tagged | +Inquiry |
KLRK1-3300R | Recombinant Rat KLRK1 Protein | +Inquiry |
BRPF1-1058H | Recombinant Human BRPF1 Protein (E1079-S1207), Tag Free | +Inquiry |
◆ Native Proteins | ||
Lectin-1864W | Active Native Succinylated Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC10-4650HCL | Recombinant Human LRRC10 293 Cell Lysate | +Inquiry |
SULT1A1-1357HCL | Recombinant Human SULT1A1 293 Cell Lysate | +Inquiry |
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
HA-2329HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
Kidney-843P | Pig Kidney Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR52H1 Products
Required fields are marked with *
My Review for All OR52H1 Products
Required fields are marked with *
0
Inquiry Basket