Recombinant Full Length Human Olfactory Receptor 4X1(Or4X1) Protein, His-Tagged
Cat.No. : | RFL18193HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4X1(OR4X1) Protein (Q8NH49) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFF LSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDR YVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVH PVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCAS HVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI GGKVI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4X1 |
Synonyms | OR4X1; Olfactory receptor 4X1; Olfactory receptor OR11-104 |
UniProt ID | Q8NH49 |
◆ Recombinant Proteins | ||
ODF1-3715H | Recombinant Human ODF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENO2-27576TH | Recombinant Human ENO2, His-tagged | +Inquiry |
RFL19759EF | Recombinant Full Length Mscs Family Inner Membrane Protein Ynai(Ynai) Protein, His-Tagged | +Inquiry |
HMGCS1-6503H | Recombinant Human HMGCS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Mad2l1bp-3896M | Recombinant Mouse Mad2l1bp Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Mucin-078P | Native Porcine Mucin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
GBA2-6001HCL | Recombinant Human GBA2 293 Cell Lysate | +Inquiry |
CDC7-7646HCL | Recombinant Human CDC7 293 Cell Lysate | +Inquiry |
CST11-7227HCL | Recombinant Human CST11 293 Cell Lysate | +Inquiry |
SLC6A20-1705HCL | Recombinant Human SLC6A20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR4X1 Products
Required fields are marked with *
My Review for All OR4X1 Products
Required fields are marked with *
0
Inquiry Basket