Recombinant Full Length Human Olfactory Receptor 4F6(Or4F6) Protein, His-Tagged
Cat.No. : | RFL16143HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4F6(OR4F6) Protein (Q8NGB9) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMY FLLANLSIINLVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAF DRYVAICKPLHYLTIMNPQRCILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCD LPRFIKLACIETYTLGFMVTANSGFISLASFLILIISYIFILVTVQKKSSGGIFKAFSML SAHVIVVVLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITPVLNPVIYTFRNKEMMVAMRR RCSQFVNYSKIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4F6 |
Synonyms | OR4F6; OR4F12; Olfactory receptor 4F6; Olfactory receptor 4F12; Olfactory receptor OR15-15 |
UniProt ID | Q8NGB9 |
◆ Recombinant Proteins | ||
C3AR1-709R | Recombinant Rat C3AR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17124MF | Recombinant Full Length Mouse Cd70 Antigen(Cd70) Protein, His-Tagged | +Inquiry |
FGF21-932P | Recombinant Pig FGF21 Protein, His&GST-tagged | +Inquiry |
CD27-1079HP | Recombinant Human CD27 protein, Fc-tagged, R-PE-labeled | +Inquiry |
IAV-03PsV | Influenza A H3N2 Pseudoviral Particles, Lentivirus-based | +Inquiry |
◆ Native Proteins | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAT1-8495HCL | Recombinant Human BCAT1 293 Cell Lysate | +Inquiry |
CENPW-7990HCL | Recombinant Human C6orf173 293 Cell Lysate | +Inquiry |
FAM19A4-001HCL | Recombinant Human FAM19A4 cell lysate | +Inquiry |
C7-1425HCL | Recombinant Human C7 cell lysate | +Inquiry |
PAX9-3411HCL | Recombinant Human PAX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR4F6 Products
Required fields are marked with *
My Review for All OR4F6 Products
Required fields are marked with *
0
Inquiry Basket