Recombinant Full Length Human Olfactory Receptor 4E1(Or4E1) Protein, His-Tagged
Cat.No. : | RFL2654HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4E1(OR4E1) Protein (P0C645) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4E1 |
Synonyms | OR4E1; OR4E1P; Olfactory receptor 4E1; Olfactory receptor OR14-43 |
UniProt ID | P0C645 |
◆ Recombinant Proteins | ||
SNTB2-2853H | Recombinant Human SNTB2, His-tagged | +Inquiry |
LGALS3BP-1544H | Recombinant Human LGALS3BP, T7-tagged | +Inquiry |
ANXA4-167R | Recombinant Rhesus Macaque ANXA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHCHD1-1624M | Recombinant Mouse CHCHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
E2-427V | Recombinant Chikungunya Virus E2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEG10-3306HCL | Recombinant Human PEG10 293 Cell Lysate | +Inquiry |
Stomach-479C | Cynomolgus monkey Stomach Lysate | +Inquiry |
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
PIP4K2C-3174HCL | Recombinant Human PIP4K2C 293 Cell Lysate | +Inquiry |
CCNG1-7707HCL | Recombinant Human CCNG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR4E1 Products
Required fields are marked with *
My Review for All OR4E1 Products
Required fields are marked with *
0
Inquiry Basket