Recombinant Full Length Human Olfactory Receptor 4C12(Or4C12) Protein, His-Tagged
Cat.No. : | RFL7097HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4C12(OR4C12) Protein (Q96R67) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFF LTHLSLIDTVYSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDC YVAICKPLNYTTIMSHSLCILLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLY PLLKLVCIDTHTLGLFVAVNSGFICLLNFLILVVSYVIILRSLKNNSLEGRCKALSTCIS HIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPMLNPVVYTLRNAEVKSAIRKLW RKKVTSDND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4C12 |
Synonyms | OR4C12; Olfactory receptor 4C12; Olfactory receptor OR11-259 |
UniProt ID | Q96R67 |
◆ Recombinant Proteins | ||
AP4B1-9725H | Recombinant Human AP4B1, GST-tagged | +Inquiry |
FCGR3A-3996H | Recombinant Human FCGR3A Protein, GST-tagged | +Inquiry |
HA-33-4019C | Recombinant Clostridium botulinum HA-33 protein, His-SUMO & Myc-tagged | +Inquiry |
DNAJB7-4693M | Recombinant Mouse DNAJB7 Protein | +Inquiry |
Lgals7-7191M | Recombinant Mouse Lectin, Galactose Binding, Soluble 7, His-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-293M | Native Mouse Prothrombin Frag-1 | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
SOD-45B | Active Native Bovine Superoxide dismutase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD109-314HCL | Recombinant Human CD109 cell lysate | +Inquiry |
AFAP1-8990HCL | Recombinant Human AFAP1 293 Cell Lysate | +Inquiry |
SZT2-905HCL | Recombinant Human SZT2 cell lysate | +Inquiry |
Small Intestine-447H | Human Small Intestine Cytoplasmic Lysate | +Inquiry |
REEP5-2426HCL | Recombinant Human REEP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR4C12 Products
Required fields are marked with *
My Review for All OR4C12 Products
Required fields are marked with *
0
Inquiry Basket