Recombinant Full Length Human Olfactory Receptor 4B1(Or4B1) Protein, His-Tagged
Cat.No. : | RFL21431HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 4B1(OR4B1) Protein (Q8NGF8) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW SKKENPGRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR4B1 |
Synonyms | OR4B1; Olfactory receptor 4B1; OST208; Olfactory receptor OR11-106 |
UniProt ID | Q8NGF8 |
◆ Recombinant Proteins | ||
PCBP3-2875Z | Recombinant Zebrafish PCBP3 | +Inquiry |
SUMO1-566H | Active Recombinant Human SUMO1 | +Inquiry |
Allc-1604M | Recombinant Mouse Allc Protein, Myc/DDK-tagged | +Inquiry |
FOXN4-3333M | Recombinant Mouse FOXN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FN1-1374H | Recombinant Human FN1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
PDHB-1860B | Native Bovine Pyruvate Dehydrogenase (lipoamide) Beta | +Inquiry |
FDP-Y-52H | Native Human Fibrinogen Degrading Product-Y | +Inquiry |
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB5-5422HCL | Recombinant Human HOXB5 293 Cell Lysate | +Inquiry |
PHF11-3237HCL | Recombinant Human PHF11 293 Cell Lysate | +Inquiry |
RGL1-1497HCL | Recombinant Human RGL1 cell lysate | +Inquiry |
TBPL2-1208HCL | Recombinant Human TBPL2 293 Cell Lysate | +Inquiry |
CD48-1258RCL | Recombinant Rat CD48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR4B1 Products
Required fields are marked with *
My Review for All OR4B1 Products
Required fields are marked with *
0
Inquiry Basket