Recombinant Full Length Human Olfactory Receptor 2Y1(Or2Y1) Protein, His-Tagged
Cat.No. : | RFL13123HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2Y1(OR2Y1) Protein (Q8NGV0) (1-311aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-311) |
Form : | Lyophilized powder |
AA Sequence : | MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMY FFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAF DRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEM PVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTC GSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGAL WKVLWRGRDSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2Y1 |
Synonyms | OR2Y1; Olfactory receptor 2Y1; Olfactory receptor OR5-2 |
UniProt ID | Q8NGV0 |
◆ Recombinant Proteins | ||
SUHB-1876B | Recombinant Bacillus subtilis SUHB protein, His-tagged | +Inquiry |
ACTN4-8099HFL | Recombinant Full Length Human ACTN4 protein, Flag-tagged | +Inquiry |
RFL27733PF | Recombinant Full Length Panax Ginseng Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged | +Inquiry |
MPV17-5522H | Recombinant Human MPV17 Protein, GST-tagged | +Inquiry |
SLC46A2-2774H | Recombinant Human SLC46A2, His-tagged | +Inquiry |
◆ Native Proteins | ||
C4A-2H | Native Human Complement C4 | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
F2-275B | Active Native Bovine α-Thrombin-DFP | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PELO-3302HCL | Recombinant Human PELO 293 Cell Lysate | +Inquiry |
SEMA4A-1979HCL | Recombinant Human SEMA4A cell lysate | +Inquiry |
HIATL1-5566HCL | Recombinant Human HIATL1 293 Cell Lysate | +Inquiry |
PDCD5-3360HCL | Recombinant Human PDCD5 293 Cell Lysate | +Inquiry |
OPTN-001HCL | Recombinant Human OPTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR2Y1 Products
Required fields are marked with *
My Review for All OR2Y1 Products
Required fields are marked with *
0
Inquiry Basket