Recombinant Full Length Human Olfactory Receptor 2T27(Or2T27) Protein, His-Tagged
Cat.No. : | RFL24801HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2T27(OR2T27) Protein (Q8NH04) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MEQSNYSVYADFILLGLFSNARFPWLLFALILLVFLTSIASNVVKIILIHIDSRLHTPMY FLLSQLSLRDILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSY DRYVAICNPLHYPVLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCE VPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRGKAVAT CSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGA LQKVVGRCVSSGKVTTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2T27 |
Synonyms | OR2T27; Olfactory receptor 2T27; Olfactory receptor OR1-67 |
UniProt ID | Q8NH04 |
◆ Recombinant Proteins | ||
RFL24095MF | Recombinant Full Length Mycoplasma Agalactiae Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
PEX19-12650M | Recombinant Mouse PEX19 Protein | +Inquiry |
ARSB-599H | Recombinant Human ARSB protein, His-tagged | +Inquiry |
AQP1-646M | Recombinant Mouse AQP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC9A8-682C | Recombinant Cynomolgus Monkey SLC9A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
Mucin-313 | Native Porcine Mucin Type III protein | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF277-104HCL | Recombinant Human ZNF277 293 Cell Lysate | +Inquiry |
Hela-02HL | HeLa Whole Cell Lysate | +Inquiry |
ROBO1-2256HCL | Recombinant Human ROBO1 293 Cell Lysate | +Inquiry |
ARIH1-8726HCL | Recombinant Human ARIH1 293 Cell Lysate | +Inquiry |
CCK-7737HCL | Recombinant Human CCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR2T27 Products
Required fields are marked with *
My Review for All OR2T27 Products
Required fields are marked with *
0
Inquiry Basket