Recombinant Full Length Human Olfactory Receptor 2L13(Or2L13) Protein, His-Tagged
Cat.No. : | RFL11912HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2L13(OR2L13) Protein (Q8N349) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM RRVFGIFSFLKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2L13 |
Synonyms | OR2L13; OR2L14; Olfactory receptor 2L13; Olfactory receptor 2L14 |
UniProt ID | Q8N349 |
◆ Recombinant Proteins | ||
EPHB4-4943H | Recombinant Human EPHB4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
WFDC1-4413H | Recombinant Human WFDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sirt2-649R | Recombinant Rat Sirt2 Protein, His-tagged | +Inquiry |
VEGFD-8114H | Recombinant Human VEGFD protein (Cys 117 Ala), His-tagged | +Inquiry |
DUS1L-4870M | Recombinant Mouse DUS1L Protein | +Inquiry |
◆ Native Proteins | ||
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBSCN-452HCL | Recombinant Human OBSCN lysate | +Inquiry |
QARS-2132HCL | Recombinant Human QARS cell lysate | +Inquiry |
USF1-480HCL | Recombinant Human USF1 293 Cell Lysate | +Inquiry |
DNAJC22-632HCL | Recombinant Human DNAJC22 cell lysate | +Inquiry |
PARVB-3425HCL | Recombinant Human PARVB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR2L13 Products
Required fields are marked with *
My Review for All OR2L13 Products
Required fields are marked with *
0
Inquiry Basket