Recombinant Full Length Human Olfactory Receptor 2B11(Or2B11) Protein, His-Tagged
Cat.No. : | RFL30339HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2B11(OR2B11) Protein (Q5JQS5) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD MKGALRRLLARIWRLCG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2B11 |
Synonyms | OR2B11; Olfactory receptor 2B11 |
UniProt ID | Q5JQS5 |
◆ Recombinant Proteins | ||
RFL35401LF | Recombinant Full Length Legionella Pneumophila Upf0761 Membrane Protein Lpc_2650 (Lpc_2650) Protein, His-Tagged | +Inquiry |
BMP8A-276H | Recombinant Human BMP8A Protein, GST-tagged | +Inquiry |
A284-RS15775-5880S | Recombinant Staphylococcus warneri SG1 A284_RS15775 protein, His-tagged | +Inquiry |
IL7-2256R | Recombinant Rhesus monkey IL7 Protein, His-tagged | +Inquiry |
PPFIA1-2599H | Recombinant Human PPFIA1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Progesterone-01H | Native Human Progesterone | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1D-7242HCL | Recombinant Human CSNK1D 293 Cell Lysate | +Inquiry |
KLHDC2-4922HCL | Recombinant Human KLHDC2 293 Cell Lysate | +Inquiry |
Adrenal-633B | Bovine Adrenal Whole Lysate, Total Protein | +Inquiry |
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
NSMCE1-1224HCL | Recombinant Human NSMCE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR2B11 Products
Required fields are marked with *
My Review for All OR2B11 Products
Required fields are marked with *
0
Inquiry Basket