Recombinant Full Length Human Olfactory Receptor 2At4(Or2At4) Protein, His-Tagged
Cat.No. : | RFL33351HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2AT4(OR2AT4) Protein (A6NND4) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR DVKAAITKIMSQDPGCDRSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2AT4 |
Synonyms | OR2AT4; Olfactory receptor 2AT4; Olfactory receptor OR11-265 |
UniProt ID | A6NND4 |
◆ Recombinant Proteins | ||
CDC26-760R | Recombinant Rhesus monkey CDC26 Protein, His-tagged | +Inquiry |
CYP2W1-2271H | Recombinant Human CYP2W1 Protein, GST-tagged | +Inquiry |
SEMG1-7640H | Recombinant Human SEMG1, His-tagged | +Inquiry |
CCDC80-6001C | Recombinant Chicken CCDC80 | +Inquiry |
CYP1A2-150H | Recombinant Human CYP1A2, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUV39H1-1334HCL | Recombinant Human SUV39H1 293 Cell Lysate | +Inquiry |
KCNK2-5036HCL | Recombinant Human KCNK2 293 Cell Lysate | +Inquiry |
SIL1-1839HCL | Recombinant Human SIL1 293 Cell Lysate | +Inquiry |
PLCD1-3129HCL | Recombinant Human PLCD1 293 Cell Lysate | +Inquiry |
ARHGAP17-8743HCL | Recombinant Human ARHGAP17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR2AT4 Products
Required fields are marked with *
My Review for All OR2AT4 Products
Required fields are marked with *
0
Inquiry Basket