Recombinant Full Length Human Olfactory Receptor 2Aj1(Or2Aj1) Protein, His-Tagged
Cat.No. : | RFL4624HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 2AJ1(OR2AJ1) Protein (Q8NGZ0) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MGHQNHTFSSDFILLGLFSSSPTSVVFFLVLFVIFIMSVTENTLMILLIRSDSRLHTPMY FLLSHLSLMDILHVSNIVPKMVTNFLSGSRTISFAGCGFQVFLSLTLLGGECLLLAAMSC DRYVAICHPLRYPILMKEYASALMAGGSWLIGVFNSTVHTAYALQFPFCGSRAIDHFFCE VPAMLKLSCADTTRYERGVCVSAVIFLLIPFSLISASYGQIILTVLQMKSSEARKKSFST CSFHMIVVTMYYGPFIFTYMRPKSYHTPGQDKFLAIFYTILTPTLNPFIYSFRNKDVLAV MKNMLKSNFLHKKMNRKIPECVFCLFLC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR2AJ1 |
Synonyms | OR2AJ1; OR2AJ1P; Olfactory receptor 2AJ1 |
UniProt ID | Q8NGZ0 |
◆ Native Proteins | ||
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
EDN3-8304H | Native Human EDN3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA1-724HCL | Recombinant Human GNPDA1 cell lysate | +Inquiry |
BEX5-8462HCL | Recombinant Human BEX5 293 Cell Lysate | +Inquiry |
ZNF134-1986HCL | Recombinant Human ZNF134 cell lysate | +Inquiry |
CEP72-7569HCL | Recombinant Human CEP72 293 Cell Lysate | +Inquiry |
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR2AJ1 Products
Required fields are marked with *
My Review for All OR2AJ1 Products
Required fields are marked with *
0
Inquiry Basket