Recombinant Full Length Human Olfactory Receptor 10Z1(Or10Z1) Protein, His-Tagged
Cat.No. : | RFL1040HF |
Product Overview : | Recombinant Full Length Human Olfactory receptor 10Z1(OR10Z1) Protein (Q8NGY1) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MGQTNVTSWRDFVFLGFSSSGELQLLLFALFLSLYLVTLTSNVFIIIAIRLDSHLHTPMY LFLSFLSFSETCYTLGIIPRMLSGLAGGDQAISYVGCAAQMFFSASWACTNCFLLAAMGF DRYVAICAPLHYASHMNPTLCAQLVITSFLTGYLFGLGMTLVIFHLSFCSSHEIQHFFCD TPPVLSLACGDTGPSELRIFILSLLVLLVSFFFITISYAYILAAILRIPSAEGQKKAFST CASHLTVVIIHYGCASFVYLRPKASYSLERDQLIAMTYTVVTPLLNPIVYSLRNRAIQTA LRNAFRGRLLGKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR10Z1 |
Synonyms | OR10Z1; Olfactory receptor 10Z1; Olfactory receptor OR1-15 |
UniProt ID | Q8NGY1 |
◆ Recombinant Proteins | ||
FCN2-4542H | Recombinant Human FCN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TFF1-27976TH | Recombinant Human TFF1 | +Inquiry |
Grhl2-3305M | Recombinant Mouse Grhl2 Protein, Myc/DDK-tagged | +Inquiry |
KRAS-40HFL | Recombinant Full Length Human KRAS Protein, C-Flag-tagged | +Inquiry |
RFL1279BF | Recombinant Full Length Bacillus Cereus Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
CII-250C | Native Chicken CII | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
CAT-5276H | Native Human, Catalase | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPMI8266-036WCY | Human Myeloma RPMI8266 Whole Cell Lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
ROBO1-2256HCL | Recombinant Human ROBO1 293 Cell Lysate | +Inquiry |
ELF1-548HCL | Recombinant Human ELF1 cell lysate | +Inquiry |
Uterus-Corpus-554R | Rhesus monkey Uterus-Corpus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR10Z1 Products
Required fields are marked with *
My Review for All OR10Z1 Products
Required fields are marked with *
0
Inquiry Basket