Recombinant Full Length Human NSUN6 Protein, C-Flag-tagged
Cat.No. : | NSUN6-1456HFL |
Product Overview : | Recombinant Full Length Human NSUN6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables tRNA (cytosine-5-)-methyltransferase activity and tRNA binding activity. Involved in tRNA C5-cytosine methylation. Located in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.6 kDa |
AA Sequence : | MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTHLASVQHVKNL LLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQ FMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSGLPELKGMGIRMTEPVYLSPSFDS VLPRYLFLQNLPSALVSHVLNPQPGEKILDLCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNAL LLGLNSIRAFCFDGTKAVKLDMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPL QRKLFTAAVQLLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKSTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | NSUN6 NOP2/Sun RNA methyltransferase 6 [ Homo sapiens (human) ] |
Official Symbol | NSUN6 |
Synonyms | NOPD1; ARL5B-AS1; 4933414E04Rik |
Gene ID | 221078 |
mRNA Refseq | NM_182543.5 |
Protein Refseq | NP_872349.1 |
MIM | 617199 |
UniProt ID | Q8TEA1 |
◆ Recombinant Proteins | ||
Nsun6-4512M | Recombinant Mouse Nsun6 Protein, Myc/DDK-tagged | +Inquiry |
NSUN6-1456HFL | Recombinant Full Length Human NSUN6 Protein, C-Flag-tagged | +Inquiry |
NSUN6-2817H | Recombinant Human NSUN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NSUN6-1553H | Recombinant Human NSUN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NSUN6-1345H | Recombinant Human NSUN6 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSUN6-3679HCL | Recombinant Human NSUN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSUN6 Products
Required fields are marked with *
My Review for All NSUN6 Products
Required fields are marked with *
0
Inquiry Basket