Recombinant Full Length Human NSMCE4A Protein, C-Flag-tagged

Cat.No. : NSMCE4A-712HFL
Product Overview : Recombinant Full Length Human NSMCE4A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Involved in positive regulation of response to DNA damage stimulus. Located in nuclear body. Part of Smc5-Smc6 complex.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 44.1 kDa
AA Sequence : MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEPSDSGDEMMDP ASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTLFNEVSRAREAVLDAHFLVLA SDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENTFN KTHTFHFLLGSIYGECPVPKPRVDRPRKVPVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFRE DPDTPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQ
GIIALSYRDWEIVKTFEISEPVITPSQRQQKPSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name NSMCE4A NSE4 homolog A, SMC5-SMC6 complex component [ Homo sapiens (human) ]
Official Symbol NSMCE4A
Synonyms NS4EA; NSE4A; C10orf86
Gene ID 54780
mRNA Refseq NM_017615.3
Protein Refseq NP_060085.2
MIM 612987
UniProt ID Q9NXX6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NSMCE4A Products

Required fields are marked with *

My Review for All NSMCE4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon