Recombinant Full Length Human NRGN Protein, His tagged

Cat.No. : NRGN-10HFL
Product Overview : Recombinant human NRGN protein, fused to Histag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-78aa
Description : Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Tag : N-His
Form : Liquid
Molecular Mass : 10 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by BCA assay)
Storage Buffer : 20mM Tris-HCl buffer (pH7.0) containing 30% glycerol 0.1mM PMSF,1mM EDTA
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Gene Name NRGN neurogranin (protein kinase C substrate, RC3) [ Homo sapiens (human) ]
Official Symbol NRGN
Synonyms NRGN; RC3; hng; neurogranin (protein kinase C substrate, RC3); neurogranin; ng; calmodulin-binding protein; protein kinase C substrate
Gene ID 4900
mRNA Refseq NM_001126181
Protein Refseq NP_001119653
MIM 602350
UniProt ID Q92686

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NRGN Products

Required fields are marked with *

My Review for All NRGN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon