Recombinant Full Length Human NR2F6 Protein, GST-tagged
Cat.No. : | NR2F6-6742HF |
Product Overview : | Human NR2F6 full-length ORF (BAG37465.1, 1 a.a. - 404 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 404 amino acids |
Description : | NR2F6 (Nuclear Receptor Subfamily 2 Group F Member 6) is a Protein Coding gene. Among its related pathways are Nuclear Receptor transcription pathway and Circadian rythm related genes. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II distal enhancer sequence-specific DNA binding. An important paralog of this gene is NR2F2. |
Molecular Mass : | 70.84 kDa |
AA Sequence : | MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR2F6 nuclear receptor subfamily 2, group F, member 6 [ Homo sapiens ] |
Official Symbol | NR2F6 |
Synonyms | NR2F6; nuclear receptor subfamily 2, group F, member 6; ERBAL2; nuclear receptor subfamily 2 group F member 6; EAR 2; ERBA-related gene-2; V-erbA-related protein 2; nuclear receptor V-erbA-related; v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2; EAR2; EAR-2; |
Gene ID | 2063 |
mRNA Refseq | NM_005234 |
Protein Refseq | NP_005225 |
MIM | 132880 |
UniProt ID | P10588 |
◆ Recombinant Proteins | ||
NR2F6-1959H | Recombinant Human NR2F6 Protein (1-404 aa), His-SUMO-tagged | +Inquiry |
NR2F6-6742HF | Recombinant Full Length Human NR2F6 Protein, GST-tagged | +Inquiry |
NR2F6-6188M | Recombinant Mouse NR2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR2F6-2915R | Recombinant Rhesus Macaque NR2F6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nr2f6-967M | Recombinant Mouse Nr2f6 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2F6-3709HCL | Recombinant Human NR2F6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR2F6 Products
Required fields are marked with *
My Review for All NR2F6 Products
Required fields are marked with *
0
Inquiry Basket