Recombinant Full Length Human NOXA1 Protein, C-Flag-tagged
Cat.No. : | NOXA1-1771HFL |
Product Overview : | Recombinant Full Length Human NOXA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTC MAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTE AASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAI PDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAP LSPGLPAMGGPGPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF RQGDTVDVLCEEPDVPLAVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NOXA1 NADPH oxidase activator 1 [ Homo sapiens (human) ] |
Official Symbol | NOXA1 |
Synonyms | p51NOX; NY-CO-31; SDCCAG31 |
Gene ID | 10811 |
mRNA Refseq | NM_006647.2 |
Protein Refseq | NP_006638.1 |
MIM | 611255 |
UniProt ID | Q86UR1 |
◆ Recombinant Proteins | ||
NOXA1-3230Z | Recombinant Zebrafish NOXA1 | +Inquiry |
NOXA1-10800M | Recombinant Mouse NOXA1 Protein | +Inquiry |
NOXA1-2934H | Recombinant Human NOXA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NOXA1-6724HF | Recombinant Full Length Human NOXA1 Protein, GST-tagged | +Inquiry |
NOXA1-1529H | Recombinant Human NOXA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOXA1-3749HCL | Recombinant Human NOXA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOXA1 Products
Required fields are marked with *
My Review for All NOXA1 Products
Required fields are marked with *
0
Inquiry Basket