Recombinant Full Length Human NOV Protein, GST-tagged

• Cat.No.: NOV-6719HF
• Product Overview: Human NOV full-length ORF ( AAH15028, 1 a.a. - 357 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 65.01 kDa
• Protein length: 357 amino acids
• AA Sequence: MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDEGSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOV nephroblastoma overexpressed [ Homo sapiens ]
• Official Symbol: NOV
• Synonyms: NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP-9; IGFBP-9
• Gene ID: 4856
• mRNA Refseq: NM_002514
• Protein Refseq: NP_002505
• MIM: 164958
• UniProt ID: P48745