Recombinant Full Length Human NOL6 Protein, GST-tagged

• Cat.No.: NOL6-6695HF
• Product Overview: Human NOL6 full-length ORF ( AAH08298, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.74 kDa
• Protein length: 200 amino acids
• AA Sequence: MVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOL6 nucleolar protein 6 (RNA-associated) [ Homo sapiens(human) ]
• Official Symbol: NOL6
• Synonyms: NOL6; NRAP; UTP22; bA311H10.1; nucleolar protein 6 (RNA-associated); nucleolar protein 6; nucleolar RNA-associated protein; nucleolar protein family 6 (RNA-associated)
• Gene ID: 65083
• mRNA Refseq: NM_022917
• Protein Refseq: NP_075068
• MIM: 611532
• UniProt ID: Q9H6R4