Recombinant Full Length Human NNMT Protein, GST-tagged

Cat.No. : NNMT-6669HF
Product Overview : Human NNMT full-length ORF ( AAH00234, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 264 amino acids
Description : N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq
Molecular Mass : 54.78 kDa
AA Sequence : MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NNMT nicotinamide N-methyltransferase [ Homo sapiens ]
Official Symbol NNMT
Synonyms NNMT; nicotinamide N-methyltransferase;
Gene ID 4837
mRNA Refseq NM_006169
Protein Refseq NP_006160
MIM 600008
UniProt ID P40261

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NNMT Products

Required fields are marked with *

My Review for All NNMT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon