Recombinant Full Length Human NNAT Protein, GST-tagged

• Cat.No.: NNAT-6667HF
• Product Overview: Human NNAT full-length ORF ( AAH01768, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 81 amino acids
• Description: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 34.65 kDa
• AA Sequence: MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NNAT neuronatin [ Homo sapiens ]
• Official Symbol: NNAT
• Synonyms: NNAT; neuronatin; Peg5; MGC1439
• Gene ID: 4826
• mRNA Refseq: NM_005386
• Protein Refseq: NP_005377
• MIM: 603106
• UniProt ID: Q16517