Recombinant Full Length Human NMT2 Protein, C-Flag-tagged
Cat.No. : | NMT2-2098HFL |
Product Overview : | Recombinant Full Length Human NMT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSAS DSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAI EPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL QWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQ AVYTAGVVLPKPIATCRYWHRSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKS VRELINTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDS EKVGLVLQ myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | NMT2 N-myristoyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | NMT2 |
Gene ID | 9397 |
mRNA Refseq | NM_004808.3 |
Protein Refseq | NP_004799.1 |
MIM | 603801 |
UniProt ID | O60551 |
◆ Recombinant Proteins | ||
NMT2-2098HFL | Recombinant Full Length Human NMT2 Protein, C-Flag-tagged | +Inquiry |
NMT2-27990TH | Recombinant Human NMT2, T7 -tagged | +Inquiry |
NMT2-3434H | Recombinant Human NMT2 protein, His-tagged | +Inquiry |
NMT2-669HF | Recombinant Full Length Human NMT2 Protein, GST-tagged | +Inquiry |
NMT2-6121M | Recombinant Mouse NMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMT2-3782HCL | Recombinant Human NMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMT2 Products
Required fields are marked with *
My Review for All NMT2 Products
Required fields are marked with *
0
Inquiry Basket