Recombinant Full Length Human NMRK1 Protein, GST-tagged

• Cat.No.: NMRK1-3820HF
• Product Overview: Human C9orf95 full-length ORF ( NP_060351.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 49.6 kDa
• Protein length: 199 amino acids
• AA Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NMRK1 nicotinamide riboside kinase 1 [ Homo sapiens (human) ]
• Official Symbol: NMRK1
• Synonyms: C9orf95; NMRK1; nicotinamide riboside kinase 1; NRK1; C9orf95; bA235O14.2; nicotinamide riboside kinase 1; NRK 1; RNK 1; nicotinic acid riboside kinase 1; nmR-K 1; ribosylnicotinamide kinase 1; ribosylnicotinic acid kinase 1; EC 2.7.1.173; EC 2.7.1.22
• Gene ID: 54981
• mRNA Refseq: NM_001127603
• Protein Refseq: NP_001121075
• MIM: 608704
• UniProt ID: Q9NWW6