Recombinant Full Length Human NME3 Protein, GST-tagged

• Cat.No.: NME3-6573HF
• Product Overview: Human NME3 full-length ORF ( AAH00250, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 169 amino acids
• Description: NME3 (NME/NM23 Nucleoside Diphosphate Kinase 3) is a Protein Coding gene. Among its related pathways are superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis and Pyrimidine metabolism (KEGG). GO annotations related to this gene include nucleoside diphosphate kinase activity. An important paralog of this gene is NME1.
• Molecular Mass: 44.33 kDa
• AA Sequence: MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ]
• Official Symbol: NME3
• Synonyms: NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; NM23 H3; NDK 3; NDP kinase 3; NDP kinase C; nucleoside diphosphate kinase C; NDPKC; NDPK-C; NM23H3; DR-nm23; NM23-H3; c371H6.2; KIAA0516
• Gene ID: 4832
• mRNA Refseq: NM_002513
• Protein Refseq: NP_002504
• MIM: 601817
• UniProt ID: Q13232