Recombinant Full Length Human NKX3-1 Protein, GST-tagged

• Cat.No.: NKX3-1-6706HF
• Product Overview: Human NKX3-1 full-length ORF ( ABZ92171.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 25.8 kDa
• Protein length: 234 amino acids
• AA Sequence: MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
• Official Symbol: NKX3-1
• Synonyms: NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1; NK homeobox, family 3, A; homeobox protein NK-3 homolog A; NK3 transcription factor homolog A; NK3 transcription factor related, locus 1; NKX3; NKX3A
• Gene ID: 4824
• mRNA Refseq: NM_001256339
• Protein Refseq: NP_001243268
• MIM: 602041
• UniProt ID: Q99801