Recombinant Full Length Human NKX2-2 Protein, GST-tagged

Cat.No. : NKX2-2-6676HF
Product Overview : Human NKX2-2 full-length ORF ( ABZ92170.1, 1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 273 amino acids
Description : The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq
Molecular Mass : 30.1 kDa
AA Sequence : MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX2-2 NK2 homeobox 2 [ Homo sapiens ]
Official Symbol NKX2-2
Synonyms NKX2-2; NK2 homeobox 2; NK 2 (Drosophila) homolog B , NK2 transcription factor related, locus 2 (Drosophila) , NKX2B; homeobox protein Nkx-2.2; NKX2.2; NK-2 homolog B; homeobox protein NK-2 homolog B; NK2 transcription factor-like protein B; NK2 transcription factor related, locus 2; NKX2B;
Gene ID 4821
mRNA Refseq NM_002509
Protein Refseq NP_002500
MIM 604612
UniProt ID O95096

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NKX2-2 Products

Required fields are marked with *

My Review for All NKX2-2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon