Recombinant Full Length Human NGFR Protein, C-Flag-tagged
Cat.No. : | NGFR-1099HFL |
Product Overview : | Recombinant Full Length Human NGFR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDS VTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQD KQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAP STQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQ NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE STATSPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, Neurotrophin signaling pathway |
Full Length : | Full L. |
Gene Name | NGFR nerve growth factor receptor [ Homo sapiens (human) ] |
Official Symbol | NGFR |
Synonyms | CD271; p75NTR; TNFRSF16; p75(NTR); Gp80-LNGFR |
Gene ID | 4804 |
mRNA Refseq | NM_002507.4 |
Protein Refseq | NP_002498.1 |
MIM | 162010 |
UniProt ID | P08138 |
◆ Recombinant Proteins | ||
NGFR-503R | Recombinant Rabbit NGFR protein(Met1-Asp242), hFc-tagged | +Inquiry |
NGFR-653H | Active Recombinant Human NGFR, Fc-tagged, Biotinylated | +Inquiry |
NGFR-1099HFL | Recombinant Full Length Human NGFR Protein, C-Flag-tagged | +Inquiry |
NGFR-169N | Active Recombinant Human NGFR Protein | +Inquiry |
NGFR-3928C | Recombinant Chicken NGFR | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGFR-1670HCL | Recombinant Human NGFR cell lysate | +Inquiry |
NGFR-1679MCL | Recombinant Mouse NGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGFR Products
Required fields are marked with *
My Review for All NGFR Products
Required fields are marked with *
0
Inquiry Basket