Recombinant Full Length Human NFE2L2 Protein, C-Flag-tagged
Cat.No. : | NFE2L2-154HFL |
Product Overview : | Recombinant Full Length Human NFE2L2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.6 kDa |
AA Sequence : | MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAF FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATF QSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVET TMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTD FGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNT SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQF NEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTL YLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | NFE2L2 NFE2 like bZIP transcription factor 2 [ Homo sapiens (human) ] |
Official Symbol | NFE2L2 |
Synonyms | NRF2; HEBP1; Nrf-2; IMDDHH |
Gene ID | 4780 |
mRNA Refseq | NM_006164.5 |
Protein Refseq | NP_006155.2 |
MIM | 600492 |
UniProt ID | Q16236 |
◆ Recombinant Proteins | ||
NFE2L2-3631R | Recombinant Rat NFE2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFE2L2-001H | Recombinant Human NFE2L2 Protein, MYC/DDK-tagged | +Inquiry |
NFE2L2-1506H | Recombinant Human NFE2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFE2L2-48HFL | Recombinant Full Length Human NFE2L2 Protein, N-His-tagged | +Inquiry |
NFE2L2-30414TH | Recombinant Human NFE2L2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFE2L2-3854HCL | Recombinant Human NFE2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFE2L2 Products
Required fields are marked with *
My Review for All NFE2L2 Products
Required fields are marked with *
0
Inquiry Basket