Recombinant Full Length Human NDUFA9 Protein
Cat.No. : | NDUFA9-334HF |
Product Overview : | Recombinant full length Human NDUFA9 with N terminal proprietary tag, 69.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 377 amino acids |
Description : | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. |
Form : | Liquid |
Molecular Mass : | 69.500kDa inclusive of tags |
AA Sequence : | MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHAL MPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQV IIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAG VEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ] |
Official Symbol | NDUFA9 |
Synonyms | NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR |
Gene ID | 4704 |
mRNA Refseq | NM_005002 |
Protein Refseq | NP_004993 |
MIM | 603834 |
UniProt ID | Q16795 |
◆ Recombinant Proteins | ||
FOXA3-5047HF | Recombinant Full Length Human FOXA3 Protein, GST-tagged | +Inquiry |
MLLT1-268H | Recombinant Human MLLT1 protein, GST-tagged | +Inquiry |
SLC17A9-15247M | Recombinant Mouse SLC17A9 Protein | +Inquiry |
NA-976V | Active Recombinant H3N2(A/Babol/36/2005) NA protein | +Inquiry |
DLGAP3-1543R | Recombinant Rat DLGAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
◆ Cell & Tissue Lysates | ||
C9orf142-138HCL | Recombinant Human C9orf142 lysate | +Inquiry |
PCSK7-3369HCL | Recombinant Human PCSK7 293 Cell Lysate | +Inquiry |
BBX-159HCL | Recombinant Human BBX cell lysate | +Inquiry |
IRF4-5165HCL | Recombinant Human IRF4 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NDUFA9 Products
Required fields are marked with *
My Review for All NDUFA9 Products
Required fields are marked with *
0
Inquiry Basket