Recombinant Full Length Human NAP1L1 Protein, C-Flag-tagged
Cat.No. : | NAP1L1-1386HFL |
Product Overview : | Recombinant Full Length Human NAP1L1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NAP1L1 nucleosome assembly protein 1 like 1 [ Homo sapiens (human) ] |
Official Symbol | NAP1L1 |
Synonyms | NRP; NAP1; NAP1L |
Gene ID | 4673 |
mRNA Refseq | NM_139207.5 |
Protein Refseq | NP_631946.1 |
MIM | 164060 |
UniProt ID | P55209 |
◆ Recombinant Proteins | ||
USP7-320H | Recombinant Human USP7 protein, His-tagged | +Inquiry |
IL4R-2388P | Recombinant Pig IL4R Protein (33-240 aa), His-tagged | +Inquiry |
RRM1-2444H | Recombinant Human RRM1, GST-tagged | +Inquiry |
Wdr46-6982M | Recombinant Mouse Wdr46 Protein, Myc/DDK-tagged | +Inquiry |
DTNBP1-2303H | Recombinant Human DTNBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
B2M-13H | Native Human B2M | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Muscles-848P | Pig S. Muscles Membrane Lysate, Total Protein | +Inquiry |
FAM175B-6404HCL | Recombinant Human FAM175B 293 Cell Lysate | +Inquiry |
Amygdala-1H | Human Amygdala(Alzheimer's Disease) Membrane Lysate | +Inquiry |
CLSTN2-7430HCL | Recombinant Human CLSTN2 293 Cell Lysate | +Inquiry |
TSC22D1-724HCL | Recombinant Human TSC22D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAP1L1 Products
Required fields are marked with *
My Review for All NAP1L1 Products
Required fields are marked with *
0
Inquiry Basket