Recombinant Full Length Human N6AMT1 Protein, GST-tagged

• Cat.No.: N6AMT1-3477HF
• Product Overview: Human HEMK2 full-length ORF ( AAH11554.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 186 amino acids
• Description: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
• Molecular Mass: 46.2 kDa
• AA Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: N6AMT1 N-6 adenine-specific DNA methyltransferase 1 (putative) [ Homo sapiens ]
• Official Symbol: N6AMT1
• Synonyms: N6AMT1; N-6 adenine-specific DNA methyltransferase 1 (putative); C21orf127, chromosome 21 open reading frame 127 , HemK methyltransferase family member 2 , HEMK2; hemK methyltransferase family member 2; MTQ2; N6AMT; PRED28; m.HsaHemK2P; N6-DNA-methyltransferase; n(6)-adenine-specific DNA methyltransferase 1; HEMK2; C21orf127; FLJ11616; MGC19995
• Gene ID: 29104
• mRNA Refseq: NM_013240
• Protein Refseq: NP_037372
• MIM: 614553
• UniProt ID: Q9Y5N5