Recombinant Full Length Human MYOZ2 Protein, GST-tagged

• Cat.No.: MYOZ2-6621HF
• Product Overview: Human MYOZ2 full-length ORF ( AAH05195, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 264 amino acids
• Description: The protein encoded by this gene belongs to a family of sarcomeric proteins that bind to calcineurin, a phosphatase involved in calcium-dependent signal transduction in diverse cell types. These family members tether calcineurin to alpha-actinin at the z-line of the sarcomere of cardiac and skeletal muscle cells, and thus they are important for calcineurin signaling. Mutations in this gene cause cardiomyopathy familial hypertrophic type 16, a hereditary heart disorder. [provided by RefSeq, Aug 2011]
• Molecular Mass: 54.78 kDa
• AA Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYOZ2 myozenin 2 [ Homo sapiens ]
• Official Symbol: MYOZ2
• Synonyms: MYOZ2; myozenin 2; C4orf5, chromosome 4 open reading frame 5; myozenin-2; CS 1; FATZ-related protein 2; muscle-specific protein; calcineurin-binding protein calsarcin-1; CS-1; CMH16; C4orf5
• Gene ID: 51778
• mRNA Refseq: NM_016599
• Protein Refseq: NP_057683
• MIM: 605602
• UniProt ID: Q9NPC6