Recombinant Full Length Human MYD88 Protein, GST-tagged

Cat.No. : MYD88-6731HF
Product Overview : Human MYD88 full-length ORF ( AAH13589.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 296 amino acids
Description : This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
Molecular Mass : 58.3 kDa
AA Sequence : MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRSITVCDYTNPCTKSWFWTRLAKALSLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ]
Official Symbol MYD88
Synonyms MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D;
Gene ID 4615
mRNA Refseq NM_001172566
Protein Refseq NP_001166037
MIM 602170
UniProt ID Q99836

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYD88 Products

Required fields are marked with *

My Review for All MYD88 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon