Recombinant Human MYD88
Cat.No. : | MYD88-29151TH |
Product Overview : | Recombinant fragment corressponding to amino acids 31-130 of Human MyD88 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ |
Sequence Similarities : | Contains 1 death domain.Contains 1 TIR domain. |
Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
Official Symbol | MYD88 |
Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; |
Gene ID | 4615 |
mRNA Refseq | NM_001172566 |
Protein Refseq | NP_001166037 |
MIM | 602170 |
Uniprot ID | Q99836 |
Chromosome Location | 3p22 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; |
Function | TIR domain binding; Toll binding; death receptor binding; identical protein binding; protein binding; |
◆ Recombinant Proteins | ||
MYD88-1550H | Recombinant Human Myeloid Differentiation Primary Response Gene (88) | +Inquiry |
MYD88-272H | Recombinant Human MYD88 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYD88-301137H | Recombinant Human MYD88 protein, GST-tagged | +Inquiry |
MYD88-7112H | Recombinant Human MYD88, His-tagged | +Inquiry |
MYD88-2737R | Recombinant Rhesus Macaque MYD88 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *
0
Inquiry Basket