Recombinant Full Length Human MTTP Protein, GST-tagged

• Cat.No.: MTTP-6566HF
• Product Overview: Human MTTP full-length ORF ( AAH62696.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 151 amino acids
• Description: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. [provided by RefSeq
• Molecular Mass: 43.3 kDa
• AA Sequence: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTTP microsomal triglyceride transfer protein [ Homo sapiens ]
• Official Symbol: MTTP
• Synonyms: MTTP; microsomal triglyceride transfer protein; microsomal triglyceride transfer protein (large polypeptide, 88kD) , microsomal triglyceride transfer protein (large polypeptide, 88kDa) , MTP; microsomal triglyceride transfer protein large subunit; ABL; microsomal triglyceride transfer protein (large polypeptide, 88kDa); MTP; MGC149819; MGC149820
• Gene ID: 4547
• mRNA Refseq: NM_000253
• Protein Refseq: NP_000244
• MIM: 157147
• UniProt ID: P55157