Recombinant Full Length Human MTHFSD Protein, GST-tagged

• Cat.No.: MTHFSD-6530HF
• Product Overview: Human MTHFSD full-length ORF (BAB14383.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 371 amino acids
• Description: MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and nucleotide binding.
• Molecular Mass: 67.2 kDa
• AA Sequence: MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARAQEVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVGSVAASEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDITVDYILTPTRVIATGCKRPKPMGITWFKISLEMMEKIPILRSLRAREQQAGKDVTLQGEHQHLPEPGCQQTVPLSVGRRPPDTPGPETNSMEAAPGSPPGEGAPLAADVYVGNLPRDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYPDSAAASRPSPACRACAWAPTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTHFSD methenyltetrahydrofolate synthetase domain containing [ Homo sapiens ]
• Official Symbol: MTHFSD
• Synonyms: MTHFSD; methenyltetrahydrofolate synthetase domain containing; methenyltetrahydrofolate synthase domain-containing protein; FLJ12998; methenyltetrahydrofolate synthetase domain-containing protein; FLJ13893; MGC138262; MGC138264; MGC177233
• Gene ID: 64779
• mRNA Refseq: NM_001159377
• Protein Refseq: NP_001152849
• MIM: 616820
• UniProt ID: Q2M296