Recombinant Full Length Human MTHFD2L Protein, GST-tagged

• Cat.No.: MTHFD2L-6529HF
• Product Overview: Human MTHFD2L full-length ORF ( AAH32771.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: MTHFD2L (Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2 Like) is a Protein Coding gene. Among its related pathways are Metabolism and One carbon pool by folate. GO annotations related to this gene include formate-tetrahydrofolate ligase activity and methylenetetrahydrofolate dehydrogenase (NADP+) activity. An important paralog of this gene is MTHFD2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.4 kDa
• Protein length: 146 amino acids
• AA Sequence: MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTHFD2L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like [ Homo sapiens ]
• Official Symbol: MTHFD2L
• Synonyms: MTHFD2L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like; probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; MGC72244; MTHFD2-like; NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein; FLJ13105; MGC45532
• Gene ID: 441024
• mRNA Refseq: NM_001144978
• Protein Refseq: NP_001138450
• MIM: 614047
• UniProt ID: Q9H903