Recombinant Full Length Human MTFR1L Protein, GST-tagged

• Cat.No.: MTFR1L-4617HF
• Product Overview: Human FAM54B full-length ORF ( AAH17175.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 292 amino acids
• Description: MTFR1L (Mitochondrial Fission Regulator 1 Like) is a Protein Coding gene. An important paralog of this gene is MTFR2.
• Molecular Mass: 58.4 kDa
• AA Sequence: MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISDLCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQRNASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADAASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPELPSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFHRMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTFR1L mitochondrial fission regulator 1 like [ Homo sapiens (human) ]
• Official Symbol: MTFR1L
• Synonyms: FAM54B; family with sequence similarity 54, member B; protein FAM54B; MST116; MSTP116; HYST1888; MTFR1L; mitochondrial fission regulator 1 like
• Gene ID: 56181
• mRNA Refseq: NM_001099625
• Protein Refseq: NP_001093095
• UniProt ID: Q9H019