Recombinant Full Length Human MSTO1 Protein, GST-tagged

• Cat.No.: MSTO1-6475HF
• Product Overview: Human MSTO1 full-length ORF ( NP_060586.2, 1 a.a. - 570 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 570 amino acids
• Description: MSTO1 (Misato 1, Mitochondrial Distribution And Morphology Regulator) is a Protein Coding gene. GO annotations related to this gene include GTPase activity.
• Molecular Mass: 88.2 kDa
• AA Sequence: MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPLSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSTO1 misato homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: MSTO1
• Synonyms: MSTO1; misato homolog 1 (Drosophila); protein misato homolog 1; FLJ10504; LST005; MST; DKFZp686B1757; DKFZp686I01261
• Gene ID: 55154
• mRNA Refseq: NM_001256532
• Protein Refseq: NP_001243461
• MIM: 617619
• UniProt ID: Q9BUK6