Recombinant Full Length Human MRPS6 Protein, GST-tagged

• Cat.No.: MRPS6-6509HF
• Product Overview: Human MRPS6 full-length ORF ( AAH10076, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 125 amino acids
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q. [provided by RefSeq
• Molecular Mass: 39.49 kDa
• AA Sequence: MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS6 mitochondrial ribosomal protein S6 [ Homo sapiens ]
• Official Symbol: MRPS6
• Synonyms: MRPS6; mitochondrial ribosomal protein S6; C21orf101, chromosome 21 open reading frame 101; 28S ribosomal protein S6, mitochondrial; MRP S6; RPMS6; S6mt; MRP-S6; C21orf101
• Gene ID: 64968
• mRNA Refseq: NM_032476
• Protein Refseq: NP_115865
• MIM: 611973
• UniProt ID: P82932