Recombinant Full Length Human MRPS28 Protein, GST-tagged

• Cat.No.: MRPS28-6497HF
• Product Overview: Human MRPS28 full-length ORF ( NP_054737.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 187 amino acids
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has been called mitochondrial ribosomal protein S35 in the literature. [provided by RefSeq
• Molecular Mass: 47.2 kDa
• AA Sequence: MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS28 mitochondrial ribosomal protein S28 [ Homo sapiens ]
• Official Symbol: MRPS28
• Synonyms: MRPS28; mitochondrial ribosomal protein S28; 28S ribosomal protein S28, mitochondrial; HSPC007; MRP S28; MRPS35; S28mt; S35mt; mitochondrial 28S ribosomal protein S35; 28S ribosomal protein S35, mitochondrial; MRP-S28; MRP-S35; FLJ22853
• Gene ID: 28957
• mRNA Refseq: NM_014018
• Protein Refseq: NP_054737
• MIM: 611990
• UniProt ID: Q9Y2Q9