Recombinant Full Length Human MRPL54 Protein, GST-tagged

Cat.No. : MRPL54-6447HF
Product Overview : Human MRPL54 full-length ORF ( NP_758455.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 42.2 kDa
Protein length : 138 amino acids
AA Sequence : MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPL54 mitochondrial ribosomal protein L54 [ Homo sapiens ]
Official Symbol MRPL54
Synonyms MRPL54; mitochondrial ribosomal protein L54; 39S ribosomal protein L54, mitochondrial; L54mt; MRP-L54;
Gene ID 116541
mRNA Refseq NM_172251
Protein Refseq NP_758455
MIM 611858
UniProt ID Q6P161

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MRPL54 Products

Required fields are marked with *

My Review for All MRPL54 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon