Recombinant Full Length Human MRPL50 Protein, GST-tagged
Cat.No. : | MRPL50-6440HF |
Product Overview : | Human MRPL50 full-length ORF ( NP_061924.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 158 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q. [provided by RefSeq |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL50 mitochondrial ribosomal protein L50 [ Homo sapiens ] |
Official Symbol | MRPL50 |
Synonyms | MRPL50; mitochondrial ribosomal protein L50; 39S ribosomal protein L50, mitochondrial; FLJ20493; mitochondrial 39S ribosomal protein L50; MRP L50; L50mt; MRP-L50; FLJ21990; |
Gene ID | 54534 |
mRNA Refseq | NM_019051 |
Protein Refseq | NP_061924 |
MIM | 611854 |
UniProt ID | Q8N5N7 |
◆ Recombinant Proteins | ||
MRPL50-2849R | Recombinant Rhesus monkey MRPL50 Protein, His-tagged | +Inquiry |
MRPL50-5594H | Recombinant Human MRPL50 Protein, GST-tagged | +Inquiry |
MRPL50-6440HF | Recombinant Full Length Human MRPL50 Protein, GST-tagged | +Inquiry |
MRPL50-3520H | Recombinant Human MRPL50 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL50-1720C | Recombinant Chicken MRPL50 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL50 Products
Required fields are marked with *
My Review for All MRPL50 Products
Required fields are marked with *
0
Inquiry Basket