Recombinant Full Length Human MRPL30 Protein, GST-tagged

• Cat.No.: MRPL30-6439HF
• Product Overview: Human MRPL30 full-length ORF ( NP_660213.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 161 amino acids
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Sequence analysis identified at least two transcript variants encoding the same protein. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. [provided by RefSeq
• Molecular Mass: 44.9 kDa
• AA Sequence: MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPL30 mitochondrial ribosomal protein L30 [ Homo sapiens (human) ]
• Official Symbol: MRPL30
• Synonyms: MRPL30; mitochondrial ribosomal protein L30; L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M; 39S ribosomal protein L30, mitochondrial; 39S ribosomal protein L28, mitochondrial; mitochondrial large ribosomal subunit protein uL30m
• Gene ID: 51263
• mRNA Refseq: NM_145212
• Protein Refseq: NP_660213
• MIM: 611838
• UniProt ID: Q8TCC3