Recombinant Full Length Human MRPL28 Protein, GST-tagged

Cat.No. : MRPL28-6435HF
Product Overview : Human MRPL28 full-length ORF ( NP_006419.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 256 amino acids
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion. [provided by RefSeq
Molecular Mass : 56.6 kDa
AA Sequence : MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPL28 mitochondrial ribosomal protein L28 [ Homo sapiens ]
Official Symbol MRPL28
Synonyms MRPL28; mitochondrial ribosomal protein L28; MAAT1, melanoma associated antigen recognised by cytotoxic T lymphocytes; 39S ribosomal protein L28, mitochondrial; p15; L28mt; MRP-L28; melanoma antigen p15; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; melanoma-associated antigen recognised by cytotoxic T lymphocytes; MAAT1; MGC8499;
Gene ID 10573
mRNA Refseq NM_006428
Protein Refseq NP_006419
MIM 604853
UniProt ID Q13084

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MRPL28 Products

Required fields are marked with *

My Review for All MRPL28 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon