Recombinant Full Length Human MPND Protein, GST-tagged

• Cat.No.: MPND-4872HF
• Product Overview: Human FLJ14981 full-length ORF ( NP_116257.2, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 471 amino acids
• Description: MPND (MPN Domain Containing) is a Protein Coding gene. GO annotations related to this gene include peptidase activity. An important paralog of this gene is MYSM1.
• Molecular Mass: 77.1 kDa
• AA Sequence: MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPND MPN domain containing [ Homo sapiens ]
• Official Symbol: MPND
• Synonyms: MPND; MPN domain containing; MPN domain-containing protein; FLJ14981
• Gene ID: 84954
• mRNA Refseq: NM_001159846
• Protein Refseq: NP_001153318
• UniProt ID: Q8N594